PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr036464.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family CO-like
Protein Properties Length: 341aa    MW: 37810.5 Da    PI: 6.3107
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr036464.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box301.1e-09443437
     zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                 + C+ +++ +++lfC+ ++ +lC +C +++H        H
  Pbr036464.1  4 KLCDSCQSAKATLFCRADSAFLCVNCDSKIHAAnklasrH 43
                 58******99*********************554555555 PP

2zf-B_box26.91e-084691342
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                  + C+ +e+ +++  C+ ++  lC +C   +H+       H++vp+
  Pbr036464.1 46 VWLCEVCEQAPVHVTCKADDAALCVTCDRDIHSAnplsrrHERVPV 91
                 689*****************************66899999999986 PP

3CCT68.32.1e-23279322144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  R a++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Pbr036464.1 279 RVARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 322
                  89****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.708148IPR000315B-box-type zinc finger
SMARTSM003362.9E-16148IPR000315B-box-type zinc finger
PfamPF006432.3E-7443IPR000315B-box-type zinc finger
CDDcd000213.42E-10548No hitNo description
PROSITE profilePS5011910.6374491IPR000315B-box-type zinc finger
PfamPF006437.7E-74691IPR000315B-box-type zinc finger
CDDcd000211.07E-84791No hitNo description
SMARTSM003364.0E-104991IPR000315B-box-type zinc finger
PfamPF062032.5E-17279321IPR010402CCT domain
PROSITE profilePS5101716.479279321IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MASKLCDSCQ SAKATLFCRA DSAFLCVNCD SKIHAANKLA SRHPRVWLCE VCEQAPVHVT  60
CKADDAALCV TCDRDIHSAN PLSRRHERVP VTPFYDSVNS AADSVPAVKS VVNFLDNRYL  120
SDVDGETEVS REEAEAASWL LPNPKAMENP DLNSGQYLFQ EMDPYLDLDY GHVDPKLEEA  180
QEQNSCGADG VVPVRSKNMQ PLLVNDQSFE LDFSAGSKPF VYGYHHAQCL SQSVSSSSMD  240
ISVVPDSNAV TDASDAYTKS LTAAVETSQL AVQLSSADRV ARVLRYREKR KNRKFEKTIR  300
YASRKAYAET RPRIKGRFAK RTEVEIEAER MCRYGVVPSF *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2465720.0KF246572.1 Pyrus pyrifolia cultivar Nakai CONSTANS-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009359063.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like isoform X1
SwissprotQ940T91e-140COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLU3N2220.0U3N222_PYRPY; CONSTANS-like protein
STRINGPOPTR_0006s28350.11e-150(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-137CONSTANS-like 4